Unua paĝo
Nia teamo
Kontaktoj
Pri ni

    ĉefpaĝo


Mtrdn1 Mtrdn2

Elŝuti 68.77 Kb.

Mtrdn1 Mtrdn2




Dato08.01.2018
Grandeco68.77 Kb.

Elŝuti 68.77 Kb.

MtRDN1 ---------------------------------------------------------------------------

MtRDN2 ---------------------------------------------------------------------------

MtRDN3 ---------------------------------------------------------------------------

Sm 150302 ---------------------------------------------------------------------------

Sm 231983 ---------------------------------------------------------------------------

Sm 235499 ---------------------------------------------------------------------------

Cr 1 ---------------------------------------------------------------------------

Cr 2 ---------------------------------------MASSTRVVIVAVAFTVVATFYSLSELHRMSAMHT-- 34

M sp 1 ---------------------------------------MAGRRVPALAFLA-AFLVAFNVFSSHGADRPSPRRA 35

Ol 1 -------------------------------------MPAAKPRRRGLARAAFALCLAYIAFTGYPAVKSPPR-- 36

M sp 2 ---------------------------------------MARVRWRSAGYLAVFVVSALATYNSLQTLHGHAR-- 34

Cr 3 ---------------------------------------------------------------------------

M sp 3 ---------------------------------------------------------------------------

M sp 4 -----MAGRR--------------------FLPKLGFVPCSIIAGIVFLVIVALAQAIAETHPDAVSDRHHGDEF 50

M sp 5 MAPFTASKRRQAKLIVYCGVTAMGLIGYGECARAPIPIGKSNAAPLSDTRVLTEPRPVLLAAILISLHAASGGSW 75

Ot 1 partial ---------------------------------------------------------------------------

Ol 2 ---------------------------------------------------------------------------

Ot 2 ------MSRR-------------------PFPGAPTSR-RTARGGITTTVVTLFIAGVVYGLVRERVTPDYSPDH 49

Ol 3 ------MKRR-------------------PFPGSSPPR-ASRGAKITSSALTLFIAACVYALIVDRVTPHFPKD- 48
MtRDN1 ---------------------------------------------------------------------------

MtRDN2 ---------------------------------------------------------------------------

MtRDN3 ---------------------------------------------------------------------------

Sm 150302 ---------------------------------------------------------------------------

Sm 231983 ---------------------------------------------------------------------------

Sm 235499 ---------------------------------------------------------------------------

Cr 1 -------------------------------------------------------MKQASTPKGKPR-------- 12

Cr 2 --DAETTKFATHTGDNNRILRAGG-------------------------QTSAISSTSAGTGQVGNT-------- 74

M sp 1 LGDLGTDATAHDDGSSRGSLTDAVGHVGGLGGWTRERGVFEELAARARRDGHPLDSRDPDTAVVDASGRRRKRVV 110

Ol 1 -----PPSRAR---TARETLTSID---------------------------APLDARSTSSARVDAP-------- 68

M sp 2 -------------------------------------------------AGRHLEVEHLHHHHHTPT-------- 52

Cr 3 ---------------------------------------------------------------------------

M sp 3 ------------------------------------------MPPSRRSKGIRGWSLVIFVLAANVAYQ------ 27

M sp 4 LSRRAHETGYRRSGSRHR-----THHGGLFGLNLDGEEGEDLKPRRARAGDEEVEEVEVVEEIVEVEED------ 114

M sp 5 AEEARRLEASRDAHSDRDFLSRDAFTGGYGVDRFGIDRSAHGIGSRGGVARPQSLGNDAYHTDGQIDPL------ 144

Ot 1 partial -----------------------------------------------XRVVKDVEDDENEGEISKKTED------ 22

Ol 2 ----------------------------------------------MGEGDEATMDDEESKEIADGADE------ 23

Ot 2 IQRPRNGHLFPSAHVDDGGLDGEAYVRERLAEKIHEHEK--EEGERRRARER----EGAKMTKTKTK-------- 110

Ol 3 -EDPTAASTLG-RFSDER--EVEAYVRERVQSRIDAYDARAAATERTKAVRRGEKGDGVAGTERRAR-------- 111
MtRDN1 ----------------------------------------------------MIVRKSMGRVKSLLMLL------ 17

MtRDN2 ----------------------------------------------------------MARASPLLMIC------ 11

MtRDN3 ----------------------------------------------------------MGCGNMFFTIL------ 11

Sm 150302 ----------------------------------------------------------MGRATFPLLIL------ 11

Sm 231983 ----------------------------------------------------------MGRISFFFLVL------ 11

Sm 235499 ----------------------------------------------------------MALSRIFLLLC------ 11

Cr 1 ------------FRLRLEHAAVFFVVAAVLFFG--------YSVFQASG--SSSSSSSSGGGGGGLITQ------ 59

Cr 2 ------------ASVSTTNTAATTSSSTAVVAA--------TTTTTTAS--TATTTTTGGSSGGHKCYT------ 121

M sp 1 KRIVRKVRRKADGTTEVISEKEEHPTDVITNAHKASEGGGQRGEARTADAVSDADKVARARSSGLKIETRRVGNV 185

Ol 1 ---------------ESPSEAE--PSSVAT--------------ARVG---PRARTTRRARAETLKLSG------ 103

M sp 2 ---------------PAASTPGHLRGSGAR--------------VADLDPFHRTPRDDGDKNPAARIDAG----- 93

Cr 3 ----------------MRRGAKAEPVTNWHR-----------------AGAILLGIIAGYVVGGAVMET------ 36

M sp 3 -----------GTRYLWRPTTGATPVSGHQREKLEIRHR------DDRRGGALLHHGHGASHGHGFHDA------ 79

M sp 4 -----------DDE--GSDGGEEADEKGSVTATRDARDDR----FDEFPASLAPLGGGGGDSPGPSCDAGDF--- 169

M sp 5 -----------GDDDADSDATASLVEQGLMEEDEFGSHH----ALGLGSGSGSDGDGDDDDDDRGAGSSDEGDVD 204

Ot 1 partial -----------EDERGGEDASGDIARKKVKVAFKSATHS------DPLLKNLAPGAPTSKTTAEFTCNG------ 74

Ol 2 -----------GSAAKIDNSSKDIADVRVKIATDSATNS------DPLLKNLAQSSVKATSEVSMTCNG------ 75

Ot 2 -----------TKTTATERQTSSHSRTSVSEKKKVIPSN------AIVRSDVAQWDGYEADEWRRIRDAEAP--- 165

Ol 3 -----------DDDDESDRAPAKVIEEGERDERGRLGEQG--AQTARVMDDISSRDGYDAEEWRRIRDAETP--- 170

MtRDN1 --------------------------------------------------------------------------M 18

MtRDN2 --------------------------------------------------------------------------L 12

MtRDN3 --------------------------------------------------------------------------I 12

Sm 150302 --------------------------------------------------------------------------I 12

Sm 231983 --------------------------------------------------------------------------L 12

Sm 235499 --------------------------------------------------------------------------L 12

Cr 1 -----------------------------------------------------------------------HNSG 63

Cr 2 -----------------------------------------------------------------------YEHT 125

M sp 1 LEPFVPAIAAADDATDAAADADADAAPPPKETKASKSWFGSSRRKRKKSDPTPTASSDSSSDSTWDSYASRKEHT 260

Ol 1 ---FQP-----------------------------------------------------------------REGF 110

M sp 2 ------------------------------------------------------------------------DDV 96

Cr 3 -----------------------------------------------------------------------ADMF 40

M sp 3 -----------------------------------------------------------------------GVHR 83

M sp 4 -----------------------------------------------------------IEHAEFWG----DVVV 181

M sp 5 PSLFDE------DD---------------------------------------EDECHESPNTEYWGELSKGVLA 234

Ot 1 partial -----------------------------------------------------------KENTELWG----SVVK 86

Ol 2 -----------------------------------------------------------KENTELWG----GVVK 87

Ot 2 -----------------------------------------------------DDECHELPLSDYWGPSPVGTAS 187

Ol 3 -----------------------------------------------------EDECHELPQSDYWGPQPLTQSV 192

MtRDN1 VLGFSFATYNLVFMMMEHK-----------------------------AGNDLGSFDG----------------K 48

MtRDN2 VLGSSFATYNLVTMIIHYG-----------------------------SADSLATEDGG-LFFDP------IVEM 51

MtRDN3 TFSVTLITYNIIISGNAPL-----------------------------KQDFPGPSRKPSIKIDP------IIKM 52

Sm 150302 TVALFIATHNTVSMVFKHRGEMS-----DQK----------------AMSDMDGNPAGGVDTYDP------LIKM 60

Sm 231983 FVAFTAAIYNTARFIAAND--------------------------------S--TLGGG---------------E 38

Sm 235499 FLVASVLTYQSLSVARSSV-----------------------------VRNFGRSRAAG-AASSA------LVSM 51

Cr 1 GLHRRTLVR--------------------------------------VGAEEDGSGEGDGQVVAK------PCPK 94

Cr 2 ELWGDVVVWGTLNKKKSAGECCD-----ACLNYQPTSPDEPGCNVWVYCGDEAKCGSQHQQCWLK------HLVH 189

M sp 1 EYGGDVVKWGETNIKRSPRECHD-----ECELLSDKKHNG-GCNVWVYCPLEGGCGTQPSGACWL------KRQG 323

Ol 1 EAGGDVVKWGDKFLKDSAEACHD-----ACVEMRDE-----GCTVFVWCGFESGCLGQPHKSCWL------KKQA 169

M sp 2 ETAVREGEFGLGASSFTTR-----------------------------SEESERTDRIDAKPKPR------LATK 136

Cr 3 YSTP-VTPKGAAAASTGVQII-----------------------------------AG--SSQTT--------NA 69

M sp 3 NDDD-VEVIEEVVYEDVVVED-----------------------------------EG--HHGSS--------RG 112

M sp 4 DGTQNLKTSASRCCEACAKIRS-----CRIWVWNPD-SKQCWLKADEREQPEP-VAKGASVAWTSGVLP-QRKGP 248

M sp 5 NGNANKAETARACCESCKKNDVV----CNAWVWDPS-SKACWMKKTT-TYQPPAY-DPAKITFTSG----ALHPT 298

Ot 1 partial DGEINVQQDAGACCNSCAELNVNGANRCSVWVYNPT-SKACWLKYEEDPVNAS--RR-------------TKNKL 145

Ol 2 DGNANKQPDAAACCDSCAKMNANGANRCSVWVYSAS-SKACWLKFDENPAAAKPANEGPGVPWTSGWFDLPKNTI 161

Ot 2 DVGA--VKSARDCCETCKKT-AG----CQFWRHDPVKPSECYTGKLMNDYLPPMYGEEHKKLTTTG----VLYPK 251

Ol 3 EGVS--ITVARDCCELCKKT-AK----CQFWRHDPAKPNECFTGTLINDYLPPMYGEEHNRKTTSG----VLYPK 256
* * *

MtRDN1 AMEIRNTNS------------------------------KYHVAVTATDAAYSQWQCRIMYYWYKKTKD----MP 89

MtRDN2 PEHVKNTKTS---------------------------KAPFHIALTATDAIYNKWQCRIMYYWYKKQRS----LP 95

MtRDN3 PLNRKSASS----------------------------KRLFHTAVTASDSVYNTWQCRVMYYWFKKMKE----SG 95

Sm 150302 PRSFKNSKKKK--------------------------KRMFHTVMTASSVPYNNWQSRVMYYWYKQQKE----KA 105

Sm 231983 EFDFNPGGK----------------------------KKLFHTVVTSSSGSYARWQCRIMYYWFKKFKD----QP 81

Sm 235499 PRDFAKARRR---------------------------ERRFHTAVTATSALYNRWQCRIMYYWYKKFKD----EA 95

Cr 1 AEQVVKTETVTVTKLVYG---------------STLQNPRAYHVVTTVAGFSNHWQARIHYYWFKKQRD--ACLR 152

Cr 2 PEASKPARTGPQTPWTSGTIDVDINADPGSDAKKASGAPRMFHTVTSAQGAAVHWQVRIHYYWWKKRKE--ECQK 262

M sp 1 RPEIPTGVSDETNPWISGSMAKPADVR-----GERGAHKKFHVLVTTNANVYQAWQVRVMHYWYERMRERCEDED 393

Ol 1 RATMTTGTEGGGNPWTSGSIYVQDDMR-----GDPDPSRKFHVVMTTNNAVYQGWQARVMYYHFQKQKA---AQG 236

M sp 2 KTEKKKDNKKG--------------------------NGKYHVLLTANDAVYVRWQSRIMYHQYKKIAT----DP 181

Cr 3 ATKTDARPAG----------------------------NTIHSVITGNGSPYQNFQGRIMYGTYKLVQKM----P 112

M sp 3 GASSGGGEGGGDPE-----------------------PSGIHVMATSNGSPYQNWQTRIMYRTFLDAAK------ 158

M sp 4 GVKYALAKDVVDPTP---------------------PPKCLHTVLTSSGNAYMNWQTRIMYQTYLKHAAE----P 298

M sp 5 QPRYAKGSASSKDP-----------------------PFCLHTMITSNGQPYMNWQTRVFHQTWRKASSA----R 346

Ot 1 partial EPKYEPATGKKD------------------------LPKCLHTIMTSSGNVYMNWQSRIMYSSYLRHAAE----P 192

Ol 2 APKYESATGKTD------------------------LPKCLHVVMTSNGNVYMNWQSRVMYSSYLRHAAE----D 208

Ot 2 IPKYDAESTDLKT--------------------------CLHTMITSNGAAYMNWQTRVFYQTWKKAASE----K 296

Ol 3 KSRYDAESTELKT--------------------------CVHTMITSNGSPYMNWQTRVFYQTWKKAASE----K 301

*** ** * * * * * *

MtRDN1 --GSAMGKFTRILHSGRGDQLMNEIPTFVVDPLPEG--LDRGYIVLNRPWAFVQWLEKA--V---IDEEYILMAE 155

MtRDN2 --GSEMGGFTRILHSGKADNLMDEIPTVVVDPLPEG--LDRGYVVLNRPWAFVQWLEKA--N---IEEEYILMAE 161

MtRDN3 DENSGMGGFTRILHSGKSDQYMDEIPTFVAQPLPSG--MDQGYIVLNRPWAFVQWLQQA--D---IKEDYILMSE 163

Sm 150302 --GSEMGGFTRLLHTGKADHLMDEIPTYVVQPLPEG--TDKGFVVLNRPWAFVQWFRDV--E---IEEDYVFMAE 171

Sm 231983 --GSEMGGFTRILHSAAPDDLMDEIPTFVADPLPSG--LDKGYIVLHRPWAFVQWLRNA--T---IEEDYIFMAE 147

Sm 235499 --GSEMGGFTRVLHSGKPDNLMDEIPTFVVDPLPPG--MDKGYVVLNRPWAFVQWLQKA--N---IEEEYIFMAE 161

Cr 1 EPACDMGGFTRVLHTGKPDDLMDEIPTVVVDPLPD---RNTTYIVLNRPYAFMQWMKLV--S---IPEKYFVMCE 219

Cr 2 QGNCEMGGFTRLLHSGQSDDLMDELPTVVVDPLPQSMVEHSWYVVLNRPYAFVQWTQRV--K---IPEPYVLMSE 332

M sp 1 PDGCQMGGFTRILHD-KADALVDEIPTCVVDRLDN----EMGFVVLSRPNAFKQYFEKCG-D---IEEDYVLMAE 459

Ol 1 PNG-QMGGFTRVLHD-VADGLEDEIPTCIVDRLED----ELGFVVLSRPFAFVQFFEKCP-Q---IEEDFILMAE 301

M sp 2 NLAGAMGGFTRILHSGKPDDLMDEIPTVVVDPLPKG-IKDHGYVVLHRPYAFKQWLDTYAAD---IEEEYVLMTE 252

Cr 3 G-GEKLTGFTRILHRMKPDDLMDEIPTFRANPLHPKCDEWCDFPVADRPNAVAQWIAAAAKEPSMIKGAWILLLE 186

M sp 3 --GSDMKHFTRLLHRRTDDELMAEVPTVRVDSLHAECDRWCEFPVADRPDAIKKWLATADSR----RGEWILMIE 227

M sp 4 --GSVMKAFTRILHRGKDDELMMEVPTMRFDPNQGKCDTWCDYPVADRSLAVAQWSQTTDSM----RCSHVMMVE 367

M sp 5 --GSPLRHFTRVLHRTRDDELVNEIHTVRIDPTHPECDNGCDYAVKDRARAIAEWTKHPDAR----RCSHVLMAE 415

Ot 1 partial --GSIMKAFTRILHKGHEDELMHEIPTMRFNPVQTKCDGWCDYPVADRSKAVADWILTADSE----RCSHVVMVE 261

Ol 2 --GSIMKAFTRILHKGREDELMHEIPTMRFNPVQAKCDGWCDYPVADRSKAVEQWLETADSE----RCSHVVMVE 277

Ot 2 --DSILRHFTRILHRTTDDELMGMIPTWRAVPTHAECDTFCDYAVKDRARAIADWMKTDDSK----RCSHILMAE 365

Ol 3 --DSVLRHFTRILHRSTDDSLMDLVPTWRADPTHVECDNSCDYAVKDRARAIAEWMKSDDSR----RCSHILMAE 370


* * * * *

MtRDN1 PDHIFVNPLPN---LATENEPAGYPFFYIKPAENE--KIMRKFYPK---ENGPVTD------VDPIGNSPVIIHK 216

MtRDN2 PDHVFVRPLPN---LAFGENPAAFPFFYIKPKENE--KIVRKYYPE---ENGPVTN------VDPIGNSPVIIRK 222

MtRDN3 PDHIIVKPIPN---LARDGMGAAFPFFYIEPKKYE--KVLRKYYPE---ENGPVTN------IDPIGNSPVIVGK 224

Sm 150302 PDHIIIRPIPN---LSTGELPAAFPFFYIDPKQFQ--KTLRRWYPE---SKGPITN------IDPIGNSPVIIKK 232

Sm 231983 PDHLITKPLPN---LASRLRPAAFPFFYITPEKYK--REVGKFF-----K-GPVQA------IDPVGNSPAIIHK 205

Sm 235499 PDHVILRPIPN---LAIDDMPAAYPFFYITPKSHE--KLLRRYFPE---DRGPITN------IDPIGNSPVIIKK 222

Cr 1 ADHLFMRPLPN---FMNGEAAGAALFTYIVPWNYN--DIVKKFIGKD-KSDEEVKK------VPQIGNSPTFIST 282

Cr 2 PDHIYLRPMPN---FMKGNAPAAFPFFYIEPSKAENVHITKKFTG-E-ITQKQLEE------IAPIGNSPTFMTF 396

M sp 1 PDHLYLRPLAN---LMNGRTAAAFPFFYINPKGFP--ELIRRFAGEH-LTDQEIED------MDPIGSSPVFIHK 522

Ol 1 PDHLYIKPVPN---LMRGDTPAAFPFFYINPKEKP--DIVRRFLPG--ITDEEMKD------IDGIGSSPVFIRK 363

M sp 2 PDHLYLRGMPL---FATPNRAAAFPFFYIDPKKPEFTPIVQKYN----EVKAPIDA------FAPIGNSPVMISV 314

Cr 3 CDYVWMRPVQAPDAYDSKTVGLQFMFDYIMPAHPDAAPLMRKLS------DNKVDP----SAIPRSGPAPVLIRY 251

M sp 3 MDYVWKKAVPMP---EPGSPAVAFHFNYINPNYPRLPEVMRSLMPP--EKRDEIKM----EDIPCTGPAPTMIRR 293

M sp 4 TDYIYVKSPSPH-ILMPRGKAIGFEYSYIYPQDLNMKRVYEEYMREHADELGRSEWKREKFALPRTGNAPSCLNV 441

M sp 5 TDYLFVRSPPPS-VLLDKGHSYGFLFGYIIPWHADAMPASREFKQF-MQREGTWREGLKIEDVPQSGNAPQVMHA 488

Ot 1 partial TDHIIVKTPSPK-ILLPQGEAMGFKFGYMNPSQPTLKKLYPEYFKD-----GQK--------MPPTGNSPSVVNT 322

Ol 2 TDHIIVKSPSPE-ILMPRGQAMGFKFGYMNPQQSRLKKMYPEYFAD-----GKK--------MPPTGNAPSVVNT 338

Ot 2 TDYLFIRSPPPS-VLLSKGYSYGFLFGYIVPSHPTAKNASKVLHD--EEKDGPLRE------VYQTGNAPQSIHR 431

Ol 3 TDYLFIRSPPPS-VLLAKGISYGFLFGYIVPSYPDAKEASVLLHD--VSKDGPLKD------VYQTGNAPQCIHR 436


* * * ** *

MtRDN1 YMLEEIAPTWVNISLRMKDDPETDKAFGWVLEMYAYAVASALHG------IKHILRKDFMLQPPWDLDVG----- 280

MtRDN2 DLIAKIAPTWMNISMKMKEDPETDKAFGWVLEMYGYAVASALHG------VRHILRKDFMLQPPWDTETF----- 286

MtRDN3 ESLKKIAPTWMNVSLAMKKDPETDKAFGWVLEMYAYAVSSALHG------VGNILHKDFMIQPPWDKELG----- 288

Sm 150302 SLLKEIAPTWMNVSLEMKNDPQADKDFGWVLEMYGYAVASAMHG------VQHVLRKDFMLQPPYDTKLE----- 296

Sm 231983 AQLLRIAPTWHNLSIQMKQDQETDKAFGWVLEMYAYAIASAVHG------VKHTLRKDFMIQPPWDTSLG----- 269

Sm 235499 SHLLRVAPTWANVSLQLKNDPAADKAFGWVLEMYGYAVASALHG------IQHILHKNFMVQPPWDGKLG----- 286

Cr 1 EQFKVLAPIWYNTTMEIFDDKEAHDAWNWVLEMYGYAIATYRAGQ----HVNMRVVPNMLAHPPFDKEEVDPEGR 353

Cr 2 EDMKKVMPTWMNVSIAVFKDQEANSVWGWVQEMYGFTIALWLNG-----IKHVDLFLNMQAQPPWDQEMHMANGK 466

M sp 1 EDLRRVAPIWHDVTLKIKQDREADKAWGWVLEMYGYTIASKIAG------VRHDLRPALMAQPPWDKGLG----- 586

Ol 1 DDLERLAPAWAEMSVALQKDKDAKAAWGWVIEMYGYTLAAYKLG------ISHDLRPQMAAQPPWDKAVG----- 427

M sp 2 ESLSRVVPKWHDLAVAMKQDPVADKAFGWVIEMWAYSIASAQVG------VTYELHPEMMLQPPWDDSFRVK-GK 382

Cr 3 TDLAGVVPEWERVTAAIEADPVAVKVLDWVREMYAWDIALALRN--VSLTTESPPHSHLIAQPPHDLVIG----- 319

M sp 3 DDLVPLMDEYERIAAAIEADPVAKNRLGWVREMYAYDLAAAIAG--VIHVVQDPGETIMIAQPPADAKMG----- 361

M sp 4 EDLRRVAPLWAEFVARTEKPEEVRKALGWLRDMYAYDAAALAVG--VEHVVAPTPRTPLMAQPPADEKIG----- 509

M sp 5 DDLARVAPTWADLVEFGEDNAVIKKVFGWVRDMYAFDFALASVG--IEVHYPPVPFNKLMVQPPADVRLG----- 556

Ot 1 partial VDLRTIAPLWWKFVNETETPEQLRKELGWVRDMYAYDLAALASG--VKHTLAEGPDSLLLAQPPADHELG----- 390

Ol 2 VDLRKIAPLWARFVNETESPESVRKELGWVRDMYAYDLAALATG--IEHELSECPESLLMAQPPADFELG----- 406

Ot 2 DDLERVAQVWAEKVELGETSDVVKKDFGWVRDMYAWSFAAAAVRPKLHFELPPVPFQKLVIQPPADITIG----- 501

Ol 3 DDLERVAPVWADKVEFGESNEVVKRVFGWVRDMYAWSFAAAAVRPKLEFELPPVPFQKLMIQPPADIAIG----- 506

* * * ** **

MtRDN1 KKFIIHFTYGCDYNLKGKLTY-GKIGEWRFDKRSYLMGPPP-------KNLSLPPPGVP-----------ESVVR 336

MtRDN2 NKYIIHYTYGCDYNLKGELTY-GKIGEWRFDKRSHLRGPPP-------RNLPLPPPGVP-----------ESVAT 342

MtRDN3 KTFIIHYTYGCDYSMKGELTY-GKIGEWRFDKRSYDLVAP--------KNLTLPPPGVP-----------ESVVT 343

Sm 150302 KKFIIHYTYGCDYTLKGEPMF-GKFGEWRFDKRSYGQGAPP-------RNLTMPPKGVH-----------ESVVT 352

Sm 231983 DKYIIHYTYGCDYTLEGVLTY-GKVGEWRFDKRSFTAGAPP-------RNLTLPPANVP-----------GSVAM 325

Sm 235499 EVYMIHYTYGCDYTMKGELTY-GKVGEWRFDKRSYTQKVMP-------QNLTLPPPGVP-----------ETVVR 342

Cr 1 PFYLLHLTYPCRYDKFGNMTDNSTLAVWTFDKREYSVKPPP-------RNLPMPPEVVHN----------NLVRL 411

Cr 2 PFYILHYTYGMDYKLSGEFTP-GKFGEWRFDKRTYGSRPPP-------RHLGEPPKNMKN----------DLVRA 523

M sp 1 EFFILHFTYGMDYDKNGVFTP-GKIGAWRFDKRSFMAGIPP-------KNLEPPPPGCDN----------ELVKR 643

Ol 1 DFISIHFTYGMDYDLDGVFTP-GKIGAWRFDKRSYSHAYPP-------KKIPDPPKGMNN----------DLVRA 484

M sp 2 EAYIIHYTYGQDFAKSGEATP-GKIGEWHFDKRDFTGFPPK-------EKIPMPPRDAH-----------EVIQK 438

Cr 3 DAAMLHYTWGTLYFE-------DKQEIWRWEKRDYTTREVALKI--PLLK-EPPQPWKEG---WKIQ---DGLPV 378

M sp 3 RASMYHYTWGAEYFK-------NGAKVWSWDKRPYVETKHVRQP--AKFK-PELPPADGSEGVYNLQ---DGKKV 423

M sp 4 DAFLLHYTWGPEIYDG------KDEKLWVFDKRSYGGGQYQRGP-YQLSKIPDPPRWDP-AAGLQLQDFFQPRTL 576

M sp 5 AASFMHYTWSPILSDK------TGATRWRFDKRQFQGAAGSSPHFVALEEQPLPPRWDP-KAGYKLQ---AGEVV 621

Ot 1 partial NAYILHYTWGPEIYDK------DDKFVWKFDKRSYGEGQYGQGP-YILQEIPPPPEWDE-SKGLQLQDFFRPRAL 457

Ol 2 NAFILHYTWGSEIYDK------NEEFIWKFDKRSYLEGQYGEGP-YILQEIPPPPEWDDGAKGLQLQTFFKPRAL 474

Ot 2 QASLMHYTWGAIVSDK------DDKKLWSFDKREYQGRWDS------LRKIETPPPWEA-ERGFKLQ---DGKVM 560

Ol 3 QSSVMHYTWGAIISNK------EDHEVWRFDKREYLGSWDS------LKKIEPLPPWDA-EQEFKLQ---DKKRI 565

MtRDN1 LVKMVNEATANIPNWDSLNRS 357

MtRDN2 LVKMVNEASANIPNWDTL 360

MtRDN3 LVKMVNEAAANIPNWSS 360

Sm 150302 LVRMINEATANIPNWKEGER 372

Sm 231983 LVKMINQATADIPNWKAGE 344

Sm 235499 LVQMVNEATANLPNWTMQ 360

Cr 1 IVGMINEATDALPCWDDYVAT-SKVNKCAHHTAQTGAKAEEAAAIAGGATKVVT 464

Cr 2 LINSINEASAALPCWDQYAETGKAVYDCDEIKTLTDPRFKNDGKGIA 570

M sp 1 LIEMMNEASANLPNWEDPLGR---GAGAGRRMLRAGWLEDPGGGVGPPPERPRPSPG 697

Ol 1 LVDAVNEASAALPDWGK----------WGTENVIAGFN 512

M sp 2 MMTIINEGITELPHWP 454

Cr 3 TRELHETMTAMLKQMNAAIS-----------TLPDLLNAPRT 409

M sp 3 SKGTDELLRDMLTLIRGAID-----------RLDELPHQPGCARKAL 459

M sp 4 SESKLELIRLMIDEFNEAVGKLP-RIPKGHKTLEEAQAMAA 616

M sp 5 TEEGLALMTMMAEAFNGGVRALPGKFPEGYDSLADVVNARTGTRR 666

Ot 1 partial TEKRLGLIKMLIDEFNVAVRALP-KVPKGYNTIEEARLYV 496

Ol 2 TEKRLGLIKTLIDEFNHAVRSLS-KIPKGYATIEEARLYV 513

Ot 2 QESQYKILQEMIEIFN---------------SAIDVILTNDAAKKTS 592



Ol 3 QKSQYEVLDKMVEIFN---------------EAVDAVVAGDG 592

Figure S5. Alignment of the predicted sequences of 13 RDN family proteins from the green algae Chlamydomonas reinhardtii (Cr), Micromonas sp. RCC299 (M sp), Ostreococcus tauri (Ot), and Ostreococcus lucimarinus (Ol) with the predicted sequences of RDN family proteins from Medicago truncatula (Mt) and Selaginella moellendorfii (Sm). Amino acid position is given along the right column. A portion of the aligned sequences (underlined in the MtRDN1 sequence) was used to generate the phylogenetic tree shown in Figure 7 and to assess the sequence conservation among RDN proteins shown in Figure 5. Positions of absolute conservation among the sequences are indicated with *. The source of the sequences is provided in Supplemental Table 1.


Elŝuti 68.77 Kb.


Elŝuti 68.77 Kb.